DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and CG13133

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster


Alignment Length:160 Identity:49/160 - (30%)
Similarity:75/160 - (46%) Gaps:39/160 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VNRNGFQVSMNVKQFAANELTVKTID-NCIVVEGQH--DEKEDGHGVISRHFIRKYILPKGYDPN 183
            :.|..|:|.::|..|..:|||||..: :.:.|||:.  |..|.|...|:|.|.|.|.||:.||..
  Fly    82 LGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDAT 146

  Fly   184 EVHSTLSSDGIL--TVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPSEVEQQAAAS 246
            :..:|.|:||||  ||.|||.|.             |:::                |:|.:...:
  Fly   147 QARATFSADGILMITVPAPPKLD-------------DVER----------------EIEIEPTGN 182

  Fly   247 ATTSTLNPTAPTPTPSLSLTLAESNGNGQE 276
            ...|..:||||.     ::..|:.:|:|.|
  Fly   183 YFGSVSDPTAPK-----AIEQADVDGDGGE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 33/80 (41%)
DNA_pol3_delta2 <218..>381 CDD:331068 12/59 (20%)
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 31/75 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.