DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and CG14207

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster


Alignment Length:172 Identity:49/172 - (28%)
Similarity:79/172 - (45%) Gaps:31/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KGQSAASQHRHHPYNRVAGAKTACCNKSLVELEKELGDKGTSGASGSTSG---------QPAASK 116
            |.:...::.||...||.|..           .|.....|.|:..|.:|:.         |...|.
  Fly    36 KMEEEMAKFRHELMNREANF-----------FESTSSTKKTTTTSSTTNSALPSRIPKQQNYVSD 89

  Fly   117 SAYSVVNRNG----FQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILP 177
            .:..::...|    .::..:|.|:|..|:.|||:|..::|..:|:||.|...|. |.:.|:::||
  Fly    90 ISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSVY-REYNREFLLP 153

  Fly   178 KGYDPNEVHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDI 219
            ||.:|..:.|:||.||:|||.||.|      :|...|.::.|
  Fly   154 KGVNPESIRSSLSKDGVLTVDAPLP------ALTAGETLIPI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 30/79 (38%)
DNA_pol3_delta2 <218..>381 CDD:331068 1/2 (50%)
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 31/81 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452101
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5129
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.