DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hspb7

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_038896.2 Gene:Hspb7 / 29818 MGIID:1352494 Length:169 Species:Mus musculus


Alignment Length:181 Identity:39/181 - (21%)
Similarity:61/181 - (33%) Gaps:72/181 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RSLAMDIDDSAGFGLYPLEATSQLPQLSRGLGRGNAMMWVPIKGQSAASQHRHHPYNRVAGAKTA 83
            ::|:|..||   ||.:.|..:..|...:|..|:||.                             
Mouse    42 KALSMFSDD---FGSFMLPHSEPLAFPARPGGQGNI----------------------------- 74

  Fly    84 CCNKSLVELEKELGDKGTSGASGSTSGQPAASKSAYSVVNRNGFQVSMNVKQFAANELTVKTIDN 148
                      |.|||                           .::.:::::.|:..::.|.|.:|
Mouse    75 ----------KTLGD---------------------------AYEFTVDMRDFSPEDIIVTTFNN 102

  Fly   149 CIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKA 199
            .|.|..   ||....|.:...|..|..||:..||..|.|.|..||.||::|
Mouse   103 HIEVRA---EKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 23/76 (30%)
DNA_pol3_delta2 <218..>381 CDD:331068
Hspb7NP_038896.2 Required for localization to SC35 splicing speckles. /evidence=ECO:0000250 1..70 9/30 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
ACD_HspB7_like 72..152 CDD:107234 29/148 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.