DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and HSPB7

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001336611.1 Gene:HSPB7 / 27129 HGNCID:5249 Length:245 Species:Homo sapiens


Alignment Length:145 Identity:34/145 - (23%)
Similarity:59/145 - (40%) Gaps:19/145 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 WVPIKGQSAASQHRHHPYNRVAGAKTACCNKSLVELEKELGDKGTSGASGS--TSGQPAASKSAY 119
            |.|::..|..:|.:..|..:.....:......:....:.|......|.:|:  |.|         
Human    99 WPPLRMASTLAQGKDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPGGAGNIKTLG--------- 154

  Fly   120 SVVNRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNE 184
                 :.::.:::|:.|:..::.|.|.:|.|.|..   ||....|.:...|..|..||:..||..
Human   155 -----DAYEFAVDVRDFSPEDIIVTTSNNHIEVRA---EKLAADGTVMNTFAHKCQLPEDVDPTS 211

  Fly   185 VHSTLSSDGILTVKA 199
            |.|.|..||.||::|
Human   212 VTSALREDGSLTIRA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 24/76 (32%)
DNA_pol3_delta2 <218..>381 CDD:331068
HSPB7NP_001336611.1 ACD_HspB7_like 148..228 CDD:107234 27/96 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148924
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.