DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Cryab

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_037067.1 Gene:Cryab / 25420 RGDID:2414 Length:175 Species:Rattus norvegicus


Alignment Length:114 Identity:43/114 - (37%)
Similarity:66/114 - (57%) Gaps:9/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VNRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVH 186
            :.::.|.|:::||.|:..||.||.:.:.|.|.|:|:|::|.||.|||.|.|||.:|...||..:.
  Rat    70 MEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTIT 134

  Fly   187 STLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPK 235
            |:|||||:|||..|      :......||.:   .|::::|......||
  Rat   135 SSLSSDGVLTVNGP------RKQASGPERTI---PITREEKPAVTAAPK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 36/75 (48%)
DNA_pol3_delta2 <218..>381 CDD:331068 4/18 (22%)
CryabNP_037067.1 Crystallin 1..52 CDD:395419
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 37/85 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..175 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342781
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.