DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hsp16

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_596091.1 Gene:hsp16 / 2540977 PomBaseID:SPBC3E7.02c Length:143 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:19/72 - (26%)
Similarity:31/72 - (43%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 TIDNCIVVEGQHDEKEDGHGVISRH---FIRKYILPKGYDPNEVHSTLSSDGILTVKAPPPLPVV 206
            ||...:|.|.:::..|.......|.   |.|...:|...|.:.:.:.. |:|:|||..|   .|.
pombe    72 TISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANF-SNGLLTVTLP---KVE 132

  Fly   207 KGSLERQ 213
            |...::|
pombe   133 KSQTKKQ 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 15/57 (26%)
DNA_pol3_delta2 <218..>381 CDD:331068
hsp16NP_596091.1 IbpA 1..143 CDD:223149 19/72 (26%)
ACD_sHsps-like 40..130 CDD:107221 16/61 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.