powered by:
Protein Alignment Hsp67Ba and hsp16
DIOPT Version :9
Sequence 1: | NP_523998.1 |
Gene: | Hsp67Ba / 39076 |
FlyBaseID: | FBgn0001227 |
Length: | 445 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_596091.1 |
Gene: | hsp16 / 2540977 |
PomBaseID: | SPBC3E7.02c |
Length: | 143 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 72 |
Identity: | 19/72 - (26%) |
Similarity: | 31/72 - (43%) |
Gaps: | 7/72 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 145 TIDNCIVVEGQHDEKEDGHGVISRH---FIRKYILPKGYDPNEVHSTLSSDGILTVKAPPPLPVV 206
||...:|.|.:::..|.......|. |.|...:|...|.:.:.:.. |:|:|||..| .|.
pombe 72 TISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANF-SNGLLTVTLP---KVE 132
Fly 207 KGSLERQ 213
|...::|
pombe 133 KSQTKKQ 139
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.