DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and SPCC338.06c

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_588161.1 Gene:SPCC338.06c / 2538739 PomBaseID:SPCC338.06c Length:139 Species:Schizosaccharomyces pombe


Alignment Length:101 Identity:25/101 - (24%)
Similarity:46/101 - (45%) Gaps:15/101 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QVSMNVKQFAANELTVKTIDNCIVVEGQHDE-KEDGHGVISR-------HFIRKYILPKGYDPNE 184
            :|.:.|.......|.|....:.:.:.|:..: :|:..|.:.|       .|.|...||:..|...
pombe    46 EVDVEVPGIDKQNLKVDLHGSKLTISGERKKPEEEKAGPLIRWSERCVGAFSRTITLPQPVDEKL 110

  Fly   185 VHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDIQ 220
            :|::| ::|||::      .:.|.:.|...|||:||
pombe   111 IHASL-NNGILSI------VMKKKNPEFTTRIVEIQ
 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 18/79 (23%)
DNA_pol3_delta2 <218..>381 CDD:331068 2/3 (67%)
SPCC338.06cNP_588161.1 IbpA 1..139 CDD:223149 23/99 (23%)
ACD_sHsps-like 37..126 CDD:107221 18/86 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.