DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hspb1

DIOPT Version :10

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_114176.4 Gene:Hspb1 / 24471 RGDID:61306 Length:206 Species:Rattus norvegicus


Alignment Length:116 Identity:48/116 - (41%)
Similarity:68/116 - (58%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GASGSTSGQPAASK-------SAYSVVNRNG--FQVSMNVKQFAANELTVKTIDNCIVVEGQHDE 158
            |.:..|...||.|:       |..|.:.:..  ::||::|..||..||||||.:..:.:.|:|:|
  Rat    66 GPAAVTLAAPAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEE 130

  Fly   159 KEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAPPPLPVVKGS 209
            ::|.||.|||.|.|||.||.|.||..|.|:||.:|.|||:||.|..|.:.:
  Rat   131 RQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 37/77 (48%)
Agg_substance 226..>432 CDD:411439
Hspb1NP_114176.4 Interaction with TGFB1I1. /evidence=ECO:0000269|PubMed:11546764 74..206 46/108 (43%)
ACD_HspB1_like 88..173 CDD:107230 39/84 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.