DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Cryaa

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001276666.1 Gene:Cryaa / 24273 RGDID:2413 Length:196 Species:Rattus norvegicus


Alignment Length:212 Identity:55/212 - (25%)
Similarity:98/212 - (46%) Gaps:35/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LEATSQLPQLSRGLGR-----------GNAMM---WVPIKGQSAASQHRHHPYNRVAGAKTACCN 86
            ::.|.|.|...|.||.           |..:.   .:|....:.:      ||.|.:..:|. .:
  Rat     1 MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTIS------PYYRQSLFRTV-LD 58

  Fly    87 KSLVELEKELGDKGTSGASGSTSGQPAASKSAYSVVNRNGFQVSMNVKQFAANELTVKTIDNCIV 151
            ..:.||...:........:|:....|...:|     :|:.|.:.::||.|:..:||||.:::.:.
  Rat    59 SGISELMTHMWFVMHQPHAGNPKNNPGKVRS-----DRDKFVIFLDVKHFSPEDLTVKVLEDFVE 118

  Fly   152 VEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAPPPLPVVKGSLE--RQE 214
            :.|:|:|::|.||.|||.|.|:|.||...|.:.:..:||:||:||...|.    |:..|:  ..|
  Rat   119 IHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPK----VQSGLDAGHSE 179

  Fly   215 RIVDIQQISQQQKDKDA 231
            |.:   .:|:::|...|
  Rat   180 RAI---PVSREEKPSSA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 30/75 (40%)
DNA_pol3_delta2 <218..>381 CDD:331068 3/14 (21%)
CryaaNP_001276666.1 Crystallin 1..51 CDD:395419 11/55 (20%)
alpha-crystallin-Hsps_p23-like 86..168 CDD:412199 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342787
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.