DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hspb6

DIOPT Version :10

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_063135425.1 Gene:Hspb6 / 192245 RGDID:621554 Length:190 Species:Rattus norvegicus


Alignment Length:103 Identity:32/103 - (31%)
Similarity:51/103 - (49%) Gaps:28/103 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FQVSMNVKQFAANELTVKTIDNCIVVEGQHDEK----------------------------EDGH 163
            |.|.::||.|:..|::||.:.:.:.|..:|:|:                            :|.|
  Rat    74 FSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPVGLLARLGSRGKQEGRILKPISSPPHSQDEH 138

  Fly   164 GVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAPP 201
            |.|:|.|.|:|.||.|.||..|.|.||.:|:|:::|.|
  Rat   139 GFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 30/100 (30%)
Agg_substance 226..>432 CDD:411439
Hspb6XP_063135425.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.