DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hsp-12.1

DIOPT Version :10

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001076614.1 Gene:hsp-12.1 / 188710 WormBaseID:WBGene00011906 Length:112 Species:Caenorhabditis elegans


Alignment Length:76 Identity:25/76 - (32%)
Similarity:43/76 - (56%) Gaps:3/76 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FQVSMNVKQFAANELTVKTIDNCIVVEGQHD---EKEDGHGVISRHFIRKYILPKGYDPNEVHST 188
            |:|.::...|..|::.||.....|::..:||   .:...:|:::|...|.|.||:..||:.|.|.
 Worm    34 FEVGLDAGFFGPNDIDVKVNGIEIIIHLRHDLLQNRPTEYGIVNREVHRTYKLPEDVDPSTVRSH 98

  Fly   189 LSSDGILTVKA 199
            |:|.|:||:.|
 Worm    99 LNSSGVLTITA 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 25/76 (33%)
Agg_substance 226..>432 CDD:411439
hsp-12.1NP_001076614.1 metazoan_ACD 26..111 CDD:107247 25/76 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.