DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hsp-17

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001023957.1 Gene:hsp-17 / 186113 WormBaseID:WBGene00002021 Length:149 Species:Caenorhabditis elegans


Alignment Length:96 Identity:41/96 - (42%)
Similarity:61/96 - (63%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 AYSVVNRN-GFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYD 181
            |..|||.: .:.||::|.||...||.|..:||.:::||:|:||.|.:|.:.|||:|||.||.|..
 Worm    47 AIDVVNNDQEYNVSVDVSQFEPEELKVNIVDNQLIIEGKHNEKTDKYGQVERHFVRKYNLPTGVR 111

  Fly   182 PNEVHSTLSSDGILTVK-------APPPLPV 205
            |.::.|.||::|:||||       .|..:|:
 Worm   112 PEQIKSELSNNGVLTVKYEKNQEQQPKSIPI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 35/83 (42%)
DNA_pol3_delta2 <218..>381 CDD:331068
hsp-17NP_001023957.1 metazoan_ACD 49..128 CDD:107247 36/78 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I4799
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.