DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hsp-43

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001123107.2 Gene:hsp-43 / 180895 WormBaseID:WBGene00002024 Length:393 Species:Caenorhabditis elegans


Alignment Length:286 Identity:66/286 - (23%)
Similarity:118/286 - (41%) Gaps:53/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 SVVNRN-GFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPN 183
            :|||.: .|.|.|:..||...|:.|||:|:.:::||:|::..|.......:|:|||.||:..|.|
 Worm   106 NVVNDDRRFAVDMDCYQFRPEEIQVKTLDDTLMIEGRHEDIRDKDNFTKMYFVRKYQLPRDVDFN 170

  Fly   184 EVHSTLSSDGILTVKAPPPLPVVKG-----SLERQERIVDIQQIS-----------QQQKDKDAQ 232
            .:.|::.:.|.|.|:|        |     :|:.:||::.|:...           :.|:..::.
 Worm   171 SIQSSIDAKGRLQVEA--------GKFNNMALQGRERMIPIEGAGHHSPRFENGTLRSQRGPNSP 227

  Fly   233 PPKPSEVEQQAAASATTSTLNPTAPT----PTPSLSLTLAESNG----NGQEETEMEMPAVSPPI 289
            ....:|.:.::.:|.:.|.||.:..:    .:.|.|...::|..    |....|..:....||..
 Worm   228 IHVQTEHDGRSVSSRSGSRLNDSPGSRDVYSSHSYSYHRSDSRNRLSPNDVNITRNDNRTYSPVT 292

  Fly   290 SNEAAAAAAVAVE--APSTAGTTSSANNGVAEPESESMEVALAKNEETANVDEPTPNPVISIEEE 352
            .....:...|..|  :|......:..||         .|.........||:.|...:   |..:.
 Worm   293 PRITTSERTVTPEQRSPGRKAFETIRNN---------FERGSYNTAGNANLHEERSS---SRAQS 345

  Fly   353 QKAEDANAN---EVPVASNNG---NG 372
            .::|..|..   |.||::..|   ||
 Worm   346 HRSESRNGGYRVESPVSTTTGILRNG 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 26/76 (34%)
DNA_pol3_delta2 <218..>381 CDD:331068 32/182 (18%)
hsp-43NP_001123107.2 metazoan_ACD 107..186 CDD:107247 29/78 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.