DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hsp-25

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001024374.1 Gene:hsp-25 / 180872 WormBaseID:WBGene00002023 Length:219 Species:Caenorhabditis elegans


Alignment Length:220 Identity:58/220 - (26%)
Similarity:97/220 - (44%) Gaps:46/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLAEELHDFNRSLAMDIDDSAG-----FGLYPLEATSQLPQLSRGLGRGNAMMWVPIKGQSAASQ 68
            :::|...|.|||....||:..|     |.........::.:|     |.....:.|..|..||..
 Worm    14 EMSERRIDVNRSNYSVIDNEFGNMRDRFEQEMRRVEEEMKRL-----RSEFEGYRPNGGPPAAIS 73

  Fly    69 HRHHPYNRVAGAKTACCNKSLVELEKELGDKGTSGASGSTSGQPA--------ASKSAYSVVNRN 125
            ::  |||  |.:.|:..:::          ...:|..||....|:        |.:..|.....|
 Worm    74 NQ--PYN--AYSNTSSHHET----------SNRTGGFGSPLPPPSFHGPSDLMAHRPTYDPYLDN 124

  Fly   126 -------------GFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILP 177
                         ..::..:|..:...|:|||||||.::|..:|:||.....|. |.:.::::||
 Worm   125 LKSPLIKDESDGKTLRLRFDVANYKPEEVTVKTIDNRLLVHAKHEEKTPQRTVF-REYNQEFLLP 188

  Fly   178 KGYDPNEVHSTLSSDGILTVKAPPP 202
            :|.:|.::.||||:||:|||:||.|
 Worm   189 RGTNPEQISSTLSTDGVLTVEAPLP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 29/88 (33%)
DNA_pol3_delta2 <218..>381 CDD:331068
hsp-25NP_001024374.1 metazoan_ACD 131..212 CDD:107247 29/81 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.