DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hsp-16.49

DIOPT Version :10

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_505356.1 Gene:hsp-16.49 / 179288 WormBaseID:WBGene00002020 Length:143 Species:Caenorhabditis elegans


Alignment Length:81 Identity:24/81 - (29%)
Similarity:44/81 - (54%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 VVN-RNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNE 184
            :|| .:.|.|.::|..|...:|.::.....:.:||..::|.: ||...|.|.:..:||:..|...
 Worm    47 IVNDESKFSVQLDVSHFKPEDLKIELDGRELKIEGIQEKKSE-HGYSKRSFSKMILLPEDVDLTS 110

  Fly   185 VHSTLSSDGILTVKAP 200
            |.|.:|::|.|.::||
 Worm   111 VKSAISNEGKLQIEAP 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 20/75 (27%)
Agg_substance 226..>432 CDD:411439
hsp-16.49NP_505356.1 metazoan_ACD 46..127 CDD:107247 24/81 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.