DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hsp-16.41

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_872116.2 Gene:hsp-16.41 / 178660 WormBaseID:WBGene00002018 Length:143 Species:Caenorhabditis elegans


Alignment Length:81 Identity:25/81 - (30%)
Similarity:43/81 - (53%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 VVN-RNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNE 184
            :|| .:.|.|.::|..|....|.:|.....:.:||..:.|.: ||.:.|.|.:..:||:..|...
 Worm    47 IVNDESKFSVQLDVSHFKPENLKIKLDGRELKIEGIQETKSE-HGYLKRSFSKMILLPEDADLPS 110

  Fly   185 VHSTLSSDGILTVKAP 200
            |.|.:|::|.|.::||
 Worm   111 VKSAISNEGKLQIEAP 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 21/75 (28%)
DNA_pol3_delta2 <218..>381 CDD:331068
hsp-16.41NP_872116.2 metazoan_ACD 46..127 CDD:107247 25/81 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.