DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hsp-12.3

DIOPT Version :10

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_501667.1 Gene:hsp-12.3 / 177777 WormBaseID:WBGene00002012 Length:109 Species:Caenorhabditis elegans


Alignment Length:71 Identity:27/71 - (38%)
Similarity:36/71 - (50%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSS 191
            |:|.:....|..||:.||.|...:.:...|..|:|..|.|:|...|.|.||||.||..:.|.|..
 Worm    33 FEVGLEAHNFLPNEIDVKNIGEFLEIHMAHTTKDDKFGSITRSITRCYRLPKGTDPATIKSKLDG 97

  Fly   192 DGILTV 197
            .|||.:
 Worm    98 SGILHI 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 27/71 (38%)
Agg_substance 226..>432 CDD:411439
hsp-12.3NP_501667.1 metazoan_ACD 30..107 CDD:107247 27/71 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.