powered by:
Protein Alignment Hsp67Ba and sip-1
DIOPT Version :9
Sequence 1: | NP_523998.1 |
Gene: | Hsp67Ba / 39076 |
FlyBaseID: | FBgn0001227 |
Length: | 445 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499316.1 |
Gene: | sip-1 / 176471 |
WormBaseID: | WBGene00004798 |
Length: | 159 |
Species: | Caenorhabditis elegans |
Alignment Length: | 74 |
Identity: | 25/74 - (33%) |
Similarity: | 41/74 - (55%) |
Gaps: | 1/74 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 FQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSS 191
|.|.::|..|...||.|....:.:.:||.|:.|.: ||...|.|.|::.|||..|...:|:.::.
Worm 53 FCVKLDVAAFKPEELKVNLEGHVLTIEGHHEVKTE-HGFSKRSFTRQFTLPKDVDLAHIHTVINK 116
Fly 192 DGILTVKAP 200
:|.:|:.||
Worm 117 EGQMTIDAP 125
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3591 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
67 |
1.000 |
Inparanoid score |
I3937 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1187096at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR45640 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.970 |
|
Return to query results.
Submit another query.