DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hspb2

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_569115.1 Gene:Hspb2 / 161476 RGDID:70914 Length:182 Species:Rattus norvegicus


Alignment Length:147 Identity:47/147 - (31%)
Similarity:72/147 - (48%) Gaps:25/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 GDKGTSGASGSTSGQPAASKSAYSVVNRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKED 161
            |:.|.:|||...             ::...||..::|..|..:|:||:|:||.:.|..:|.::.|
  Rat    57 GEGGRAGASELR-------------LSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLD 108

  Fly   162 GHGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQ 226
            .||.:||.|.|.|:||...||..|.:.||.||||.::||           |..|.:| .::::..
  Rat   109 RHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAP-----------RGGRHLD-TEVNEVY 161

  Fly   227 KDKDAQPPKPSEVEQQA 243
            ......||.|.|.|:.|
  Rat   162 ISLLPAPPDPEEEEEVA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 31/75 (41%)
DNA_pol3_delta2 <218..>381 CDD:331068 7/26 (27%)
Hspb2NP_569115.1 Crystallin <16..51 CDD:395419
alpha-crystallin-Hsps_p23-like 67..148 CDD:412199 33/104 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.