DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Cryab

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001276711.1 Gene:Cryab / 12955 MGIID:88516 Length:175 Species:Mus musculus


Alignment Length:114 Identity:44/114 - (38%)
Similarity:68/114 - (59%) Gaps:9/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VNRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVH 186
            :.::.|.|:::||.|:..||.||.:.:.|.|.|:|:|::|.||.|||.|.|||.:|...||..:.
Mouse    70 LEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTIT 134

  Fly   187 STLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPK 235
            |:|||||:|||..|      :..:...||.:   .|::::|...|..||
Mouse   135 SSLSSDGVLTVNGP------RKQVSGPERTI---PITREEKPAVAAAPK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 36/75 (48%)
DNA_pol3_delta2 <218..>381 CDD:331068 5/18 (28%)
CryabNP_001276711.1 Crystallin 1..52 CDD:395419
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 37/85 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..175 9/39 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838977
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.