DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Cryaa

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001265498.1 Gene:Cryaa / 12954 MGIID:88515 Length:202 Species:Mus musculus


Alignment Length:213 Identity:57/213 - (26%)
Similarity:99/213 - (46%) Gaps:31/213 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LEATSQLPQLSRGLGR-----------GNAMM---WVPIKGQSAASQHRHHPYNRVAGAKTACCN 86
            ::.|.|.|...|.||.           |..:.   .:|....:.:      ||.|.:..:|. .:
Mouse     1 MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTIS------PYYRQSLFRTV-LD 58

  Fly    87 KSLVELEKELGDKGTSGASGSTSGQPA-ASKSAYSVVNRNGFQVSMNVKQFAANELTVKTIDNCI 150
            ..:.||...:........:|:....|. ||..|....:|:.|.:.::||.|:..:||||.:::.:
Mouse    59 SGISELMTHMWFVMHQPHAGNPKNNPVKASYMAKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFV 123

  Fly   151 VVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAPPPLPVVKGSLE--RQ 213
            .:.|:|:|::|.||.|||.|.|:|.||...|.:.:..:||:||:||...|.    |:..|:  ..
Mouse   124 EIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPK----VQSGLDAGHS 184

  Fly   214 ERIVDIQQISQQQKDKDA 231
            ||.:   .:|:::|...|
Mouse   185 ERAI---PVSREEKPSSA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 30/75 (40%)
DNA_pol3_delta2 <218..>381 CDD:331068 3/14 (21%)
CryaaNP_001265498.1 Crystallin 1..50 CDD:278926 10/54 (19%)
alpha-crystallin-Hsps_p23-like 90..174 CDD:294116 31/83 (37%)
IbpA <93..174 CDD:223149 30/80 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838983
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.