Protein Alignment Hsp67Ba and HSPB6

DIOPT Version :9

• Sequence 1: NP_523998.1
• Gene: Hsp67Ba / 39076
• FlyBaseID: FBgn0001227
• Length: 445
• Species: Drosophila melanogaster
• Sequence 2: NP_653218.1
• Gene: HSPB6 / 126393
• HGNCID: 26511
• Length: 160
• Species: Homo sapiens
• Alignment Length: 83
• Identity: 33/83 - (39%)
• Similarity: 50/83 - (60%)
• Gaps: 7/83 - (8%)

  Fly   127 FQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSS 191
            |.|.::||.|:..|:.||.:...:.|..:|:|:.|.||.::|.|.|:|.||.|.||..|.|.||.
Human    74 FSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSP 138

  Fly   192 DGILTV-------KAPPP 202
            :|:|::       :||||
Human   139 EGVLSIQAAPASAQAPPP 156

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Hsp67Ba	NP_523998.1	metazoan_ACD	124..200	CDD:107247	29/79 (37%)
		DNA_pol3_delta2	<218..>381	CDD:331068
HSPB6	NP_653218.1	Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000269|PubMed:27717639	1..72
		Crystallin	3..58	CDD:395419
		ACD_HspB4-5-6	66..144	CDD:107233	29/69 (42%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1187096at2759
OrthoFinder	1	1.000	-	-		FOG0000383
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR45640
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	4	4.020