DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and Hspb8

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_446064.1 Gene:Hspb8 / 113906 RGDID:71003 Length:196 Species:Rattus norvegicus


Alignment Length:218 Identity:54/218 - (24%)
Similarity:86/218 - (39%) Gaps:73/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IDDSAGFGLYPLEATS-----QLPQLSRG---------LGRG---NAMMWVPIKGQSAASQHRHH 72
            :||..|...:|.:.|:     .||:||..         :.||   .|...||.:|::..      
  Rat    31 LDDGFGMDPFPDDLTAPWPEWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRNPP------ 89

  Fly    73 PYNRVAGAKTACCNKSLVELEKELGDKGTSGASGSTSGQPAASKSAYSVVNRNGFQVSMNVKQFA 137
            |:                                  .|:|              ::|.:||..|.
  Rat    90 PF----------------------------------PGEP--------------WKVCVNVHSFK 106

  Fly   138 ANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAP-- 200
            ..||.|||.|..:.|.|:|:||:...|::|::|.:|..||...||..|.::||.:|:|.::||  
  Rat   107 PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQV 171

  Fly   201 PPLPVVKGSLERQERIVDIQQIS 223
            ||......|....|...|.|:::
  Rat   172 PPYSPFGESSFNNELPQDNQEVT 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 28/75 (37%)
DNA_pol3_delta2 <218..>381 CDD:331068 2/6 (33%)
Hspb8NP_446064.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
ACD_HspB8_like 80..170 CDD:107235 35/143 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.