DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hspb6

DIOPT Version :10

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_002940672.2 Gene:hspb6 / 100494296 XenbaseID:XB-GENE-876273 Length:168 Species:Xenopus tropicalis


Alignment Length:120 Identity:43/120 - (35%)
Similarity:71/120 - (59%) Gaps:12/120 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PAASKSAYSVV--NRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKY 174
            |..|::..|.|  :::.|.|.::||.|:..|||||.:.:.:.|..:|:|:.|.||.|||.|.|:|
 Frog    59 PQPSEAGLSEVKLDKDQFSVLLDVKHFSPEELTVKVVGDYVEVHAKHEERPDEHGFISREFHRRY 123

  Fly   175 ILPKGYDPNEVHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDK 229
            .:|....|..:.|.||::|:|:::|    ||..|. :::||.:.|     .:|||
 Frog   124 KIPPTVSPAAISSALSAEGLLSIQA----PVTAGG-KQEERSIPI-----ARKDK 168

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 29/75 (39%)
Agg_substance 226..>432 CDD:411439 3/4 (75%)