DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hsp30d

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_002937646.1 Gene:hsp30d / 100489362 XenbaseID:XB-GENE-5917036 Length:215 Species:Xenopus tropicalis


Alignment Length:181 Identity:51/181 - (28%)
Similarity:86/181 - (47%) Gaps:41/181 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CCNKSLVELEKELG-----DKGTSGASGSTSG-QPAASKSAYSVVNRNGFQVSMNVKQFAANELT 142
            |.|::...|.:::.     |:.....:..|.| .|::.|.     .::.|:::::|:.|:.:|||
 Frog    52 CVNEAYRLLSQDMDMRRITDQSRQPRAAETEGTSPSSGKD-----GKDHFELTLDVRDFSPHELT 111

  Fly   143 VKTIDNCIVVEGQHDEK---EDG---HGVISRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAP- 200
            ||.....::|.|:.:.|   |||   |..  |.:.|:..||:|.:|.:|..:.|.||.|.::|| 
 Frog   112 VKMQGRRVIVTGKQERKSDSEDGSYFHEY--REWKREAELPEGVNPEQVVCSFSKDGHLHIQAPR 174

  Fly   201 ---PPLPVVKGSLERQERIVDIQQISQQQKDKDAQ--PP----KPSEVEQQ 242
               ||.|         ||.:   .||.....:|||  ||    ..::.|||
 Frog   175 LALPPAP---------ERPI---PISMDPAPRDAQEIPPDAQNSNADGEQQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 26/81 (32%)
DNA_pol3_delta2 <218..>381 CDD:331068 10/31 (32%)
hsp30dXP_002937646.1 ACD_HspB9_like 88..174 CDD:107236 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5129
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.