DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and LOC100489207

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_012822866.2 Gene:LOC100489207 / 100489207 -ID:- Length:206 Species:Xenopus tropicalis


Alignment Length:157 Identity:48/157 - (30%)
Similarity:75/157 - (47%) Gaps:27/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KELGDKGTSGASGSTSG-QPAASKSAYSVVNRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHD 157
            :.:.|:.....:..|.| .|::.|.     .::.|::.::|..|:.:|:||||....::|.|:|:
 Frog    61 RRITDQSRQPRATETEGTSPSSDKD-----GKDHFELMLDVGDFSPHEITVKTQGRRVIVTGKHE 120

  Fly   158 EK---EDGHGVIS-RHFIRKYILPKGYDPNEVHSTLSSDGILTVKAP----PPLPVVKGSLERQE 214
            .|   |||..|.. |.:.|:..||:|.:..:|..:||.||.|.:|||    ||.|         |
 Frog   121 RKSDSEDGSYVHEYREWNRRAELPEGVNLEQVVCSLSKDGHLHIKAPWLALPPAP---------E 176

  Fly   215 RIVDIQQISQQQKDKDAQP-PKPSEVE 240
            |.:   .||.......||| |..|..|
 Frog   177 RPI---PISMNMAPSVAQPMPXNSNAE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 28/79 (35%)
DNA_pol3_delta2 <218..>381 CDD:331068 8/24 (33%)
LOC100489207XP_012822866.2 ACD_HspB9_like 82..167 CDD:107236 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5129
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.