DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and cryaa

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_031752202.1 Gene:cryaa / 100488185 XenbaseID:XB-GENE-5940571 Length:115 Species:Xenopus tropicalis


Alignment Length:105 Identity:40/105 - (38%)
Similarity:65/105 - (61%) Gaps:5/105 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 NRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHS 187
            :|:.|.::::||.|:..:|:||..|:.:.:.|:|:|::|.||.|||.|.|:|.||...|.|.|..
 Frog    11 DRDRFFINLDVKHFSPEDLSVKLHDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQNSVSC 75

  Fly   188 TLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQK 227
            |||:||||:...|...|.|..|  ..:|.:   .:|:::|
 Frog    76 TLSADGILSFSGPKLQPNVDSS--HSDRTI---PVSREEK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 33/75 (44%)
DNA_pol3_delta2 <218..>381 CDD:331068 2/10 (20%)
cryaaXP_031752202.1 alpha-crystallin-Hsps_p23-like 5..89 CDD:412199 33/77 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.