DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and si:dkey-1k23.3

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_002662020.3 Gene:si:dkey-1k23.3 / 100331249 ZFINID:ZDB-GENE-160113-121 Length:365 Species:Danio rerio


Alignment Length:295 Identity:81/295 - (27%)
Similarity:123/295 - (41%) Gaps:68/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSS 191
            :::|::|..||..|::||.....:.:.|:|:|::||||.|:|.|.|||.||.|.:...:.::||:
Zfish    99 WKISLDVNHFAPAEISVKIQHGFLEIAGKHEERQDGHGFIARSFTRKYNLPGGIEVENLQTSLSA 163

  Fly   192 DGILTVKAP-P--PLPVVKGSLERQERIVDIQQIS--------QQQKDKDAQPPKPSEVEQQAAA 245
            ||||||:|| |  |||.        :.|:.||..|        ||..||.....||...:     
Zfish   164 DGILTVEAP
FPSIPLPA--------DVIIPIQVESGAQTIAGKQQDGDKPQDDIKPESFD----- 215

  Fly   246 SATTSTLNPTAPTPTPSLSLTLAESNGNGQEETEMEMPAVSPPISNEAAAAAAVAVEAPSTAGTT 310
                      ..||..|:|    ..:.:..:.||.:...||....:..|...::| ||.|  |.:
Zfish   216 ----------GKTPESSVS----AGHPDAGKVTERDQQTVSDVDPSREAQPQSIA-EAAS--GFS 263

  Fly   311 SSANNGVAEP--------ESESMEVALAKNEETANVDEP----TPNPVISIEEEQKAEDANANEV 363
            .|....|.||        |....|.......:..:.|:|    ||:.:.|       |.|...::
Zfish   264 VSGREQVGEPLAGREKDKEGRFQETVEGIQRDGESADKPLAPETPDTITS-------EQAEVIQL 321

  Fly   364 PVASNNGNGAVAAAEDVEMPLAKKPEISTEDSKEE 398
                    |.:...|....|...:.|.||....:|
Zfish   322 --------GDLEGEEGCTGPAVMREEQSTFGQSQE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 31/72 (43%)
DNA_pol3_delta2 <218..>381 CDD:331068 38/182 (21%)
si:dkey-1k23.3XP_002662020.3 alpha-crystallin-Hsps_p23-like 88..172 CDD:320797 31/72 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7249
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5233
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.