DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Ba and hspb9

DIOPT Version :9

Sequence 1:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001108177.1 Gene:hspb9 / 100137108 ZFINID:ZDB-GENE-080214-6 Length:204 Species:Danio rerio


Alignment Length:105 Identity:22/105 - (20%)
Similarity:45/105 - (42%) Gaps:11/105 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GTSGASGSTSGQPAASKSAYSVVNRNGFQVSMNVKQFAANELTVKTIDNCI-VVEGQHDEKEDGH 163
            |:|..|...|..|...|       :....::::.:.|:..:::|......: |:.|:..||....
Zfish    68 GSSTFSRLFSTDPEQKK-------KQDVSLTLDTRGFSPEDVSVTVSGRRLEVMAGKRAEKNASS 125

  Fly   164 GVI---SRHFIRKYILPKGYDPNEVHSTLSSDGILTVKAP 200
            ...   ::.|::...||...||..:..:|..||:|.::.|
Zfish   126 SSAESQAQEFVQAVQLPDHLDPASLTCSLGEDGLLHIETP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 15/79 (19%)
DNA_pol3_delta2 <218..>381 CDD:331068
hspb9NP_001108177.1 IbpA 38..180 CDD:223149 22/105 (21%)
ACD_HspB9_like 79..166 CDD:107236 18/94 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582855
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.