DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and HSPB9

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_149971.1 Gene:HSPB9 / 94086 HGNCID:30589 Length:159 Species:Homo sapiens


Alignment Length:156 Identity:37/156 - (23%)
Similarity:57/156 - (36%) Gaps:40/156 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LGTQQRRSINGCPCASPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPS 101
            :|..:|..:...|..  :...|||.|         ..||       | .:||||:.:|...|.|.
Human    21 VGLAERNRVATMPVR--LLRDSPAAQ---------EDND-------H-ARDGFQMKLDAHGFAPE 66

  Fly   102 ELNVKVVDDSILVEGKHEERQDDHGHI---MRHFVRRYKVPDGYKAEQVVSQLSSDGVL-----T 158
            ||.|:|....::|.|:.:....|...:   |...|.|..:|.......:...|:..|.|     .
Human    67 ELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQC 131

  Fly   159 VSIPKPQAVEDKSKERIIQIQQVGPA 184
            |::..|:|             |.||:
Human   132 VALALPEA-------------QTGPS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 22/85 (26%)
IbpA <87..179 CDD:223149 24/99 (24%)
HSPB9NP_149971.1 ACD_HspB9_like 45..131 CDD:107236 24/93 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.