DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and HSPB3

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_006299.1 Gene:HSPB3 / 8988 HGNCID:5248 Length:150 Species:Homo sapiens


Alignment Length:109 Identity:35/109 - (32%)
Similarity:60/109 - (55%) Gaps:3/109 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PAGQVLALRREMANRN---DIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEE 120
            |...::.||:..|.::   |.........||..||:.:||.||.|.::.::..:..:|::.:|..
Human    38 PGPTIVDLRKTRAAQSPPVDSAAETPPREGKSHFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGT 102

  Fly   121 RQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKP 164
            |.|:||.|.|.|.|:||:|||.:.:.:.:.|..||:|.|.:..|
Human   103 RMDEHGFISRSFTRQYKLPDGVEIKDLSAVLCHDGILVVEVKDP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 29/77 (38%)
IbpA <87..179 CDD:223149 28/78 (36%)
HSPB3NP_006299.1 ACD_HspB3_Like 63..145 CDD:107232 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148899
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.