DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and HSP26

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_009628.1 Gene:HSP26 / 852364 SGDID:S000000276 Length:214 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:33/127 - (25%)
Similarity:53/127 - (41%) Gaps:43/127 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DIHWPATAHVGKDGFQVCMDVAQFKPSELN------VKVVDDSILVEGKHEERQDDHGHIMRHFV 133
            ||.:    |..|:...|..::    ||.||      |||.:.|   .||              |.
Yeast   120 DIEY----HQNKNQILVSGEI----PSTLNEESKDKVKVKESS---SGK--------------FK 159

  Fly   134 RRYKVPD--GYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANES 193
            |...:||  |..|:.:.:.. ::||||:::||.:..:| .|..:.:|:        |.:.||
Yeast   160 RVITLPDYPGVDADNIKADY-ANGVLTLTVPKLKPQKD-GKNHVKKIE--------VSSQES 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 22/85 (26%)
IbpA <87..179 CDD:223149 25/99 (25%)
HSP26NP_009628.1 IbpA 72..205 CDD:223149 29/111 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.