DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and AT1G59860

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_176195.1 Gene:AT1G59860 / 842280 AraportID:AT1G59860 Length:155 Species:Arabidopsis thaliana


Alignment Length:133 Identity:40/133 - (30%)
Similarity:68/133 - (51%) Gaps:25/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PSSPAGQVLALRREMANRNDIHWPAT--AHVGKDGFQVCMDVAQFKPSELNVKVVDDSIL-VEGK 117
            |||.:..:...|        :.|..|  |||.|      .|:...|..|:.|::.|||:| :.|:
plant    36 PSSSSSAIANAR--------VDWKETAEAHVFK------ADLPGMKKEEVKVEIEDDSVLKISGE 86

  Fly   118 H----EERQDDHGHIMRH---FVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERI 175
            .    ||:||....:.|.   |.|::::|:..|.:||.:.: .:|||||::||.:..:.|::.:.
plant    87 RHVEKEEKQDTWHRVERSSGGFSRKFRLPENVKMDQVKASM-ENGVLTVTVPKVETNKKKAQVKS 150

  Fly   176 IQI 178
            |.|
plant   151 IDI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 26/85 (31%)
IbpA <87..179 CDD:223149 30/100 (30%)
AT1G59860NP_176195.1 ACD_ScHsp26_like 47..138 CDD:107229 32/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.