DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and AT1G54050

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001323264.1 Gene:AT1G54050 / 841843 AraportID:AT1G54050 Length:155 Species:Arabidopsis thaliana


Alignment Length:136 Identity:32/136 - (23%)
Similarity:58/136 - (42%) Gaps:25/136 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILV---E 115
            |.|.|.:|:.....|...:.|:|  |.........:...:|:.....|::.|.|.::..||   .
plant    20 ILPISRSGESNNESRGRGSSNNI--PIDILESPKEYIFYLDIPGISKSDIQVTVEEERTLVIKSN 82

  Fly   116 GKHEERQDDHG-----------HIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSI-------P 162
            || .:|.||..           .:.::.|:::::|:......|.::. .:|||||.|       |
plant    83 GK-RKRDDDESEEGSKYIRLERRLAQNLVKKFRLPEDADMASVTAKY-QEGVLTVVIKKLPPQPP 145

  Fly   163 KPQAVE 168
            ||:.|:
plant   146 KPKTVQ 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 20/98 (20%)
IbpA <87..179 CDD:223149 24/103 (23%)
AT1G54050NP_001323264.1 ACD_sHsps-like 45..137 CDD:107221 19/93 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.