DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and AT1G52560

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_175665.1 Gene:AT1G52560 / 841687 AraportID:AT1G52560 Length:232 Species:Arabidopsis thaliana


Alignment Length:101 Identity:22/101 - (21%)
Similarity:49/101 - (48%) Gaps:14/101 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DGFQVCMDVAQFKPSELNVKVVDDSILVEGKH---EER----QDDH--GHIMRHFVRRYKVPDGY 142
            |.:::..:|......::.:.|.|..:.::|.|   ||:    :|::  .....::.....:||..
plant   134 DCYKLRYEVPGLTKEDVKITVNDGILTIKGDHKAEEEKGSPEEDEYWSSKSYGYYNTSLSLPDDA 198

  Fly   143 KAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQI 178
            |.|.:.::| .:|||.:.||:    .:|.|:.:.:|
plant   199 KVEDIKAEL-KNGVLNLVIPR----TEKPKKNVQEI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 18/84 (21%)
IbpA <87..179 CDD:223149 22/101 (22%)
AT1G52560NP_175665.1 ACD_sHsps-like 129..218 CDD:107221 18/84 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.