DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and AT5G37670

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_198583.1 Gene:AT5G37670 / 833746 AraportID:AT5G37670 Length:137 Species:Arabidopsis thaliana


Alignment Length:118 Identity:30/118 - (25%)
Similarity:59/118 - (50%) Gaps:23/118 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IHWPAT--AHVGKDGFQVCMDVAQFKPSELNVKVVDDSILV---EG-KHEERQDDHGHIMR---- 130
            |.|..:  :|:.|      ::|..:...::.|::.:.::|.   || |.|::::...|:..    
plant    24 IDWMESNNSHIFK------INVPGYNKEDIKVQIEEGNVLSIRGEGIKEEKKENLVWHVAEREAF 82

  Fly   131 -----HFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQI 178
                 .|:||.::|:..|.:||.:.: .:|||||.:||..: ...||.|.:.|
plant    83 SGGGSEFLRRIELPENVKVDQVKAYV-ENGVLTVVVPKDTS-SKSSKVRNVNI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 21/90 (23%)
IbpA <87..179 CDD:223149 26/105 (25%)
AT5G37670NP_198583.1 ACD_ScHsp26_like 24..119 CDD:107229 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.