DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and AT5G20970

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_197597.1 Gene:AT5G20970 / 832222 AraportID:AT5G20970 Length:249 Species:Arabidopsis thaliana


Alignment Length:126 Identity:24/126 - (19%)
Similarity:48/126 - (38%) Gaps:30/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 AQFKPSELNVK----------VVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQV--- 147
            |.||.::|.::          ....:.::...|::.:...|...:..|.:   |.|.|.:|:   
plant    83 AMFKDNKLYIRHPKLKTEIPQTKPPTPVIMKPHDQHERKQGQGPKAMVEK---PSGGKTDQLKHD 144

  Fly   148 VSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEVKGKENGAPNGKDK 208
            ..||..|.         |.::..::::..::.|.|...|.     .|.||..:...:.|||
plant   145 AQQLKHDA---------QQLKHDAQQKAREVVQSGKNKLT-----GEPKGPLSSKDDEKDK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 14/79 (18%)
IbpA <87..179 CDD:223149 15/95 (16%)
AT5G20970NP_197597.1 ACD_sHsps-like 19..96 CDD:107221 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.