DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and HSP17.6A

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_196764.1 Gene:HSP17.6A / 831076 AraportID:AT5G12030 Length:156 Species:Arabidopsis thaliana


Alignment Length:110 Identity:33/110 - (30%)
Similarity:59/110 - (53%) Gaps:11/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSIL-VEGKHE-ERQDDHG-------HIMRHFVR 134
            ||......|.:...:|:...|..|:.|::.::::| |.||.: :.:::.|       ..|..|:|
plant    47 PADVIEHPDAYVFAVDMPGIKGDEIQVQIENENVLVVSGKRQRDNKENEGVKFVRMERRMGKFMR 111

  Fly   135 RYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQ 179
            ::::||....|: :|...:||||.|:|||....|.| |.:.||:|
plant   112 KFQLPDNADLEK-ISAACNDGVLKVTIPKLPPPEPK-KPKTIQVQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 23/86 (27%)
IbpA <87..179 CDD:223149 30/100 (30%)
HSP17.6ANP_196764.1 HSP20 49..137 CDD:365807 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.