DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and HSP17.6II

DIOPT Version :10

Sequence 1:NP_523997.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_196763.1 Gene:HSP17.6II / 831075 AraportID:AT5G12020 Length:155 Species:Arabidopsis thaliana


Alignment Length:110 Identity:27/110 - (24%)
Similarity:56/110 - (50%) Gaps:11/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRH---------FVR 134
            ||......:.:...:|:...|..|:.|:|.:|::||.....:|::.....:::         |:|
plant    46 PADVIEHPNAYAFVVDMPGIKGDEIKVQVENDNVLVVSGERQRENKENEGVKYVRMERRMGKFMR 110

  Fly   135 RYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQ 179
            ::::|:....:: :|.:..||||.|::.|....|.| |.:.||:|
plant   111 KFQLPENADLDK-ISAVCHDGVLKVTVQKLPPPEPK-KPKTIQVQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_523997.1 metazoan_ACD 85..163 CDD:107247 18/86 (21%)
HSP17.6IINP_196763.1 HSP20 48..136 CDD:459629 18/88 (20%)

Return to query results.
Submit another query.