DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and HSP21

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_194497.1 Gene:HSP21 / 828881 AraportID:AT4G27670 Length:227 Species:Arabidopsis thaliana


Alignment Length:159 Identity:32/159 - (20%)
Similarity:71/159 - (44%) Gaps:25/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QQRRSINGCP--CASPICPSSPAGQVLALRREM-------ANRN-------DIHWPATAHVGKDG 88
            |||.:::..|  ...|:.|.....|:|.....|       :.||       :|..|......:..
plant    73 QQRLTMDVSPFGLLDPLSPMRTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHE 137

  Fly    89 FQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDD---HGHIMRHFVRRYKVPDGYKAEQVVSQ 150
            .::..|:......::.:.|.|:.::::|:.::...|   .|..:..:..|.::||..:.:::.::
plant   138 IKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAE 202

  Fly   151 LSSDGVLTVSIPKPQAVEDKSKERIIQIQ 179
            | .:|||.::|||     .|.:.::|.:|
plant   203 L-KNGVLFITIPK-----TKVERKVIDVQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 14/80 (18%)
IbpA <87..179 CDD:223149 18/94 (19%)
HSP21NP_194497.1 IbpA 90..225 CDD:223149 26/140 (19%)
HSP20 130..227 CDD:278440 19/102 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.