DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and HSP17.4

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_190209.1 Gene:HSP17.4 / 823768 AraportID:AT3G46230 Length:156 Species:Arabidopsis thaliana


Alignment Length:137 Identity:42/137 - (30%)
Similarity:69/137 - (50%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SPICPSSPAGQVLALRREMANRNDIHWPAT--AHVGKDGFQVCMDVAQFKPSELNVKVVDDSIL- 113
            :|...::||..|.|.     ....:.|..|  |||.|      .||...|..|:.|:|.|.:|| 
plant    32 TPGLTNAPAKDVAAF-----TNAKVDWRETPEAHVFK------ADVPGLKKEEVKVEVEDGNILQ 85

  Fly   114 VEG----KHEERQDDHGHIMR---HFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKS 171
            :.|    ::||:.|....:.|   .|:||:::|:..|.|:|.:.: .:|||:|::||.|  |.|.
plant    86 ISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASM-ENGVLSVTVPKVQ--ESKP 147

  Fly   172 KERIIQI 178
            :.:.:.|
plant   148 EVKSVDI 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 26/85 (31%)
IbpA <87..179 CDD:223149 31/100 (31%)
HSP17.4NP_190209.1 ACD_ScHsp26_like 50..141 CDD:107229 31/97 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.