DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and AT3G10680

DIOPT Version :10

Sequence 1:NP_523997.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_187679.1 Gene:AT3G10680 / 820237 AraportID:AT3G10680 Length:490 Species:Arabidopsis thaliana


Alignment Length:78 Identity:22/78 - (28%)
Similarity:38/78 - (48%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEVK 196
            |...|:|||.....: :|...|.|:||:..  |..||...:|:.:|.|:    .:..::|:.:..
plant    80 FSEAYRVPDTCDMTK-LSTSFSHGLLTIEF--PAIVEANKQEKAVQDQE----KIGQRSNQEKSG 137

  Fly   197 GK-ENGAPNGKDK 208
            |. .||:..|:.|
plant   138 GPGPNGSTLGRKK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_523997.1 metazoan_ACD 85..163 CDD:107247 10/30 (33%)
AT3G10680NP_187679.1 ACD_sHsps-like 32..109 CDD:107221 10/31 (32%)
PTZ00121 <149..438 CDD:173412 1/2 (50%)

Return to query results.
Submit another query.