DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and AT2G19310

DIOPT Version :10

Sequence 1:NP_523997.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_179521.1 Gene:AT2G19310 / 816448 AraportID:AT2G19310 Length:162 Species:Arabidopsis thaliana


Alignment Length:69 Identity:17/69 - (24%)
Similarity:33/69 - (47%) Gaps:14/69 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 DDHGHIM-----RHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPK------PQ--AVEDKSKER 174
            |:.|::.     ..|:.|:|:|:....:||.:.: .|..|.|.:.|      ||  .:|:....|
plant    90 DEEGYLQICTGDNKFMSRFKLPNNALTDQVTAWM-EDEFLVVFVEKDASSSPPQLPEIEENRNVR 153

  Fly   175 IIQI 178
            :::|
plant   154 VVEI 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_523997.1 metazoan_ACD 85..163 CDD:107247 11/44 (25%)
AT2G19310NP_179521.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 61..134 CDD:469641 11/44 (25%)

Return to query results.
Submit another query.