powered by:
Protein Alignment Hsp26 and AT2G19310
DIOPT Version :9
Sequence 1: | NP_001287000.1 |
Gene: | Hsp26 / 39075 |
FlyBaseID: | FBgn0001225 |
Length: | 208 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_179521.1 |
Gene: | AT2G19310 / 816448 |
AraportID: | AT2G19310 |
Length: | 162 |
Species: | Arabidopsis thaliana |
Alignment Length: | 69 |
Identity: | 17/69 - (24%) |
Similarity: | 33/69 - (47%) |
Gaps: | 14/69 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 DDHGHIM-----RHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPK------PQ--AVEDKSKER 174
|:.|::. ..|:.|:|:|:....:||.:.: .|..|.|.:.| || .:|:....|
plant 90 DEEGYLQICTGDNKFMSRFKLPNNALTDQVTAWM-EDEFLVVFVEKDASSSPPQLPEIEENRNVR 153
Fly 175 IIQI 178
:::|
plant 154 VVEI 157
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1187096at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.