DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hspb11

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001092897.1 Gene:hspb11 / 796767 ZFINID:ZDB-GENE-030131-5148 Length:205 Species:Danio rerio


Alignment Length:130 Identity:41/130 - (31%)
Similarity:62/130 - (47%) Gaps:13/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PATAHVGKDG--FQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDD----HGHIMRHFVRRYK 137
            |.:..:||:|  :.:.:|...|.|.||.||.|...:.|.||.|::|||    :.:..:.|.:.:.
Zfish    75 PISFQLGKEGSHYALTLDTQDFSPEELAVKQVGRKLRVSGKTEKKQDDGKGSYSYRCQEFRQEFD 139

  Fly   138 VPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEVKGKENGA 202
            :|:|...|.|...| ::|.|.:..|:..  ...|.||:|.|... ||..|.....||   .||.|
Zfish   140 LPEGVNPESVSCSL-NNGQLQIQAPREG--NTVSNERVIPITYT-PAVKNPALQNSE---PENQA 197

  Fly   203  202
            Zfish   198  197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 26/83 (31%)
IbpA <87..179 CDD:223149 29/97 (30%)
hspb11NP_001092897.1 IbpA 36..177 CDD:223149 32/104 (31%)
ACD_HspB9_like 81..164 CDD:107236 26/83 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..205 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582862
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.