DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hspb3

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_113938.1 Gene:Hspb3 / 78951 RGDID:68345 Length:152 Species:Rattus norvegicus


Alignment Length:139 Identity:41/139 - (29%)
Similarity:65/139 - (46%) Gaps:26/139 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 HSRYVLPLGT-QQRRSINGCPCA---SPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQ 90
            |:.|.||..| :..|...|.|.|   ......:|.|:                      ||..||
  Rat    32 HALYALPGPTIEDLRKARGTPKALAEDSDSAETPPGE----------------------GKSRFQ 74

  Fly    91 VCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDG 155
            :.:||.||.|.::.::..:..:|::.:|..|.|:||.|.|.|.|:||:|||.:.:.:.:.|..||
  Rat    75 ILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVETKDLSAILCHDG 139

  Fly   156 VLTVSIPKP 164
            :|.|.:..|
  Rat   140 ILVVEVKDP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 29/77 (38%)
IbpA <87..179 CDD:223149 28/78 (36%)
Hspb3NP_113938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..69 5/42 (12%)
ACD_HspB3_Like 65..147 CDD:107232 31/103 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342774
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.