DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hspb1

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001072817.1 Gene:hspb1 / 780278 XenbaseID:XB-GENE-480320 Length:211 Species:Xenopus tropicalis


Alignment Length:150 Identity:50/150 - (33%)
Similarity:80/150 - (53%) Gaps:16/150 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PSSPAGQVL-----ALRREMANR-NDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILV 114
            |::|||...     ||.|::::. ::|...:      |.:::.:||..|.|.||.:|..|..:.:
 Frog    68 PTTPAGATAPDFNRALSRQLSSGISEIRQTS------DQWKISLDVNHFAPEELVIKTKDGIVEI 126

  Fly   115 EGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQ 179
            .|||||:||:||.|.|.|.|:|.:|.|....:|.|.||.||:|||..|.|:.....::   |.|.
 Frog   127 TGKHEEKQDEHGFISRCFTRKYTLPPGVDINKVASSLSPDGILTVEAPLPKPAIQSAE---IAIP 188

  Fly   180 QVGPAHLNVKANESEVKGKE 199
            ....:...:...|:: ||:|
 Frog   189 ITFQSRAEIGTTEAK-KGEE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 34/77 (44%)
IbpA <87..179 CDD:223149 37/91 (41%)
hspb1NP_001072817.1 ACD_HspB1_like 90..175 CDD:107230 35/90 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I6892
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5925
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.