DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and Hspb9

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_083583.2 Gene:Hspb9 / 75482 MGIID:1922732 Length:168 Species:Mus musculus


Alignment Length:142 Identity:31/142 - (21%)
Similarity:58/142 - (40%) Gaps:17/142 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QRRSINGCPCASPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNV 105
            :.|..:.||..:....:..|...:.|.|:....|....|:        ||:.:|...|.|.:|.|
Mouse    17 ENRVASRCPSVALAERNQVATLPVRLLRDEVQGNGCEQPS--------FQIKVDAQGFAPEDLVV 73

  Fly   106 KVVDDSILVEG--KHEERQDDHG-HIMRHFV-RRYKVPDGYKAEQVVSQLSSDGVLTV-----SI 161
            ::...::.|.|  :||......| :.|...| |:.::|.......:...|:..|.|.:     .:
Mouse    74 RIDGQNLTVTGQRQHESNDPSRGRYRMEQSVHRQMQLPPTLDPAAMTCSLTPSGHLWLRGQNKCL 138

  Fly   162 PKPQAVEDKSKE 173
            |.|:|...:|::
Mouse   139 PPPEAQTGQSQK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 19/86 (22%)
IbpA <87..179 CDD:223149 23/96 (24%)
Hspb9NP_083583.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 1/7 (14%)
ACD_HspB9_like 50..135 CDD:107236 21/92 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..104 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..168 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.