DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hspb3

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001092922.1 Gene:hspb3 / 568180 ZFINID:ZDB-GENE-070705-338 Length:150 Species:Danio rerio


Alignment Length:76 Identity:28/76 - (36%)
Similarity:46/76 - (60%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPD-GYKAEQVV 148
            |:..||:.:||.||||.::.::|.:..:|:.|:|..|..:||.:.|.|.|.|::|| ...|..:.
Zfish    64 GEPMFQILLDVTQFKPEDILIQVFEGWLLIRGRHGVRMGEHGLVSRSFTRHYQLPDCQLHAGDLK 128

  Fly   149 SQLSSDGVLTV 159
            :.|..||:|.|
Zfish   129 AMLCHDGMLVV 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 28/76 (37%)
IbpA <87..179 CDD:223149 27/74 (36%)
hspb3NP_001092922.1 ACD_HspB3_Like 60..143 CDD:107232 28/76 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582849
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.