DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hspb2

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001017744.1 Gene:hspb2 / 550439 ZFINID:ZDB-GENE-050417-260 Length:169 Species:Danio rerio


Alignment Length:112 Identity:38/112 - (33%)
Similarity:58/112 - (51%) Gaps:11/112 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQL 151
            |.::|.:||.||.|.|::|:.||:.:.|..:|.:|.|.||.:.|.|.|.|.:|.|.....|...|
Zfish    69 DWYRVLLDVCQFTPDEISVRTVDNLLEVSARHAQRMDQHGFVSREFTRTYILPMGVDPLLVQVSL 133

  Fly   152 SSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEVKGK 198
            |.||:|.:..|:      |:::...||.|     |.:|..:.|...|
Zfish   134 SHDGILCIQAPR------KTEDLEPQINQ-----LKIKVEKKESTSK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 29/75 (39%)
IbpA <87..179 CDD:223149 32/91 (35%)
hspb2NP_001017744.1 ACD_HspB2_like 63..145 CDD:107231 29/75 (39%)
IbpA <64..162 CDD:223149 36/103 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.