DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp26 and hspb7

DIOPT Version :9

Sequence 1:NP_001287000.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001006040.1 Gene:hspb7 / 450019 ZFINID:ZDB-GENE-041010-136 Length:161 Species:Danio rerio


Alignment Length:118 Identity:31/118 - (26%)
Similarity:47/118 - (39%) Gaps:23/118 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ICPSSPAGQVLALRREMANRNDIHWPATAHVGK-----DGFQVCMDVAQFKPSELNVKVVDDSIL 113
            :||....|        ..||       |..||.     |.:|..:||..|.|.::.|...::.|.
Zfish    48 MCPKDALG--------FPNR-------TGTVGNIKTLGDTYQFTVDVQDFSPEDVIVTTSNNQIE 97

  Fly   114 VEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQA 166
            |   |.|:....|.:|..|..:.::|:......|.|.|.:||.||:...:..|
Zfish    98 V---HAEKLASDGTVMNTFTHKCRLPEDVDPTSVKSSLGADGTLTIKAQRNTA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 23/82 (28%)
IbpA <87..179 CDD:223149 23/80 (29%)
hspb7NP_001006040.1 ACD_HspB7_like 64..144 CDD:107234 23/82 (28%)
IbpA <65..158 CDD:223149 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.